PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009776476.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family ZF-HD
Protein Properties Length: 946aa    MW: 104175 Da    PI: 6.1654
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009776476.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer98.55.1e-31711766359
     ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                     ++rY eClkNhAas+Ggha+DGCgEfmps g egt+ alkC AC+CHRnFHR++  +
  XP_009776476.1 711 SIRYMECLKNHAASMGGHAIDGCGEFMPS-GGEGTPGALKCEACNCHRNFHRKKIIN 766
                     789*************************9.8899*******************9765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF141111.7E-6209288IPR025558Domain of unknown function DUF4283
PfamPF047701.1E-28712763IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.3E-28713763IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257747.0E-20713764IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.382714763IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 946 aa     Download sequence    Send to blast
MKPDNHTAKV EGRDETLGIM ELDKNEHIGG GNEYGSKESE AAPKNTHILE DGLYISDSVD  60
CVPEATHSDS AERVASPVNC STATSEIQAS AETSCSGSSG LSFASDGIAG GIPSVMDDSS  120
SMCSTDSMSF RGTYSNHNIQ KLYGRGWKYG SKSTSNAADW ASEKLNQPLD ALPIGEHHED  180
RKSRPPIQVQ YSTYRGRQAV TFPENYWESL VPDCKLTLIG NFFQRKPRMK EIRADFIAKN  240
PLKGQVKITH YTSQQVSLDF TNEADYDTVL SKKTLTVAVM QISWWSRDIH HEVGKQEWKA  300
MDKERDVKPG IMEQQKTELD ELIGGETEYK IDAPEAVLET PDILGEVSDV SNSLHIVPEV  360
AHPDFRDNDA SPVNCDTDTS KMHPSIGITC CQLSGISAPQ NMIDGTSPYV MNVNSSKCST  420
YSILSIVTTG LSSNDKDQSK SIRDVADSAS KAHSQPLDDL PEARQQMLKK DVAVSHQSEL  480
TESDRERHSS EIPSVSSPPR SPPRSIGSVI QLMSKLKVSV TNDPNSVKRS TSDNSNLTQK  540
SVPLFNSAEN AVLLSVDPHK SIEPKAIEKP LVRSISITTE NFPSNQVTAS ATAEMPMPLL  600
PTLPLLAHSV SPAAQLCADP PTAIDTYVPQ SYPNGIVGSH IFGRSEQAGS GSIFPSPSQA  660
LHQHSLAQRH SQLNSYKVDK NAHLDQESNM IAGPTQLQSL LTTSVSDTTS SIRYMECLKN  720
HAASMGGHAI DGCGEFMPSG GEGTPGALKC EACNCHRNFH RKKIINHRQM AGIGSHIEPR  780
NNSNSRNIHK QSPISQQYQH NYSYSPSSVV NSSDSYPQLP LPISGQICLP QGLEKKEPSL  840
IRPSYSYEMV NHDTVQQWEY FWRDRSRNTS IDHPSLRNEN QNFDMFKPLN YRTSDNIPSE  900
FANEFPHLDI INNLRYDEHG KGRTLMPNSG FQNLSNGSYH LNGHFT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009776474.10.0PREDICTED: uncharacterized protein LOC104226233 isoform X2
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02540.15e-23homeobox protein 21